Certikin Spafresh 1 Litre Surface Cleaner – Pack Of 6 (SFSUC/6)

12 people are viewing this product
Sales in the last 24 hours: 20

£173.25 £121.28

  • Complete Spa Cleaning: Certikin Spafresh 1 Litre Surface Cleaner effectively removes dirt and grime, ensuring a sparkling clean spa experience.
  • Sanitizing Power: Keep your spa or hot tub free from harmful bacteria with this powerful surface cleaner that sanitizes effectively.
  • Easy Maintenance: Simplify your spa upkeep routine with this convenient pack of 6 surface cleaner bottles for long-lasting use.
  • Professional Grade: Trusted by spa professionals, this cleaner is formulated to deliver exceptional results with every use.
  • Versatile Use: Suitable for various spa surfaces, this cleaner is gentle yet effective, ensuring no damage to your spa’s finish.
  • Quick Action: With its fast-acting formula, this surface cleaner saves you time and effort, giving you more time to enjoy your spa.
  • Safe and Reliable: Rest assured that this product is safe for you and your spa, meeting high-quality standards for your peace of mind.
  • Enhanced Spa Experience: Experience a fresher and more inviting spa environment with this surface cleaner’s thorough cleaning capabilities.
  • Chemical Balance: Maintain the right chemical balance in your spa with this cleaner, ensuring optimal performance and longevity of your equipment.
  • Professional Results: Achieve professional-level cleanliness with this surface cleaner, elevating your spa experience to new heights.
  • Please check the stock note in the description for our quickest delivery times.

In stock

Title Quantity SALE price
Sale / Bulk discount 1 £138.60
Sale / Bulk discount 2 £133.40
Sale / Bulk discount 3 - 4 £129.94
Sale / Bulk discount 5 - 7 £128.21
Sale / Bulk discount 8 - 11 £124.74
Sale / Bulk discount 12 + £121.28

Certikin Spafresh 1 Litre Surface Cleaner is a top-of-the-line cleaning solution designed specifically for spas and hot tubs. This pack contains 6 bottles of the powerful surface cleaner, ensuring you have an ample supply to keep your spa pristine and inviting with minimal effort.

Keeping your spa clean is not just about aesthetics; it is essential for maintaining a safe and hygienic environment for you and your guests to enjoy. The Spafresh Surface Cleaner is formulated to effectively remove dirt, oils, and other contaminants that can accumulate on the surface of your spa, ensuring that your water stays crystal clear and free from impurities.

One of the standout features of the Certikin Spafresh Surface Cleaner is its superior cleaning power. With just a small amount of this concentrated formula, you can achieve remarkable results, effortlessly eliminating grime and residue from your spa’s surfaces. Whether you are dealing with stubborn stains or routine maintenance, this cleaner is up to the task.

Moreover, the Spafresh Surface Cleaner is specially designed to be gentle on spa surfaces while still delivering a deep clean. This means you can trust that your spa’s delicate materials will not be damaged during the cleaning process, allowing you to maintain the beauty and integrity of your investment for years to come.

Convenience is another key benefit of using the Certikin Spafresh Surface Cleaner. The 1-litre bottles are easy to handle and store, ensuring that you always have a supply of this essential cleaning solution on hand. Whether you are a spa owner or a professional in the industry, having a reliable and effective cleaner like Spafresh at your disposal can streamline your maintenance routine and enhance the overall experience for you and your guests.

Regular use of the Spafresh Surface Cleaner can also help extend the life of your spa equipment by preventing the buildup of grime and residue that can lead to corrosion or other damage. By incorporating this cleaner into your maintenance regimen, you are not only preserving the appearance of your spa but also safeguarding its functionality for years to come.

For added convenience and peace of mind, the Certikin Spafresh Surface Cleaner is part of a comprehensive range of spa maintenance products. By exploring the Spa Fresh brochure and accompanying documentation, you can discover a complete suite of solutions designed to support the upkeep and longevity of your spa, from water balancing products to specialty treatments.

When it comes to maintaining your spa, quality matters. Trust Certikin Spafresh 1 Litre Surface Cleaner to deliver exceptional results, ease of use, and peace of mind, ensuring that your spa remains a haven of relaxation and enjoyment for you and your guests. Invest in the best for your spa with Certikin Spafresh.

Manufacturers description:

Certikin Spafresh 1 Litre Surface Cleaner – Pack Of 6

The Spafresh range contains all the chemicals necessary for maintaining and sanitising a spa or hot tub. Take a look at the Spa Fresh brochure for more details.

Product documentation:

chem_br_spafresh_guide-573.pdf

350msdsspafreshalkalinityincreaser201013-905.pdf

351msdsspafreshhardnessincreaser151113-906.pdf

352msdsspafreshsurfacecleaner201013-907.pdf

355msdsspafreshphreducer201013-908.pdf

356msdsspafreshphplus201013-909.pdf

357msdsspafreshmultifunctionminichlorinetablets151113-910.pdf

360msdsspafreshbrominetablets-un3085121113-911.pdf

363msdsspafreshsystemflush040213-912.pdf

365msdsspafreshfoamfree070114-913.pdf

Stock note: In an effort to provide the quickest possible delivery for our customers we may ship an alternative premium branded product if stocks are low. These brands will only be Blue Horizons, Deep Blue Pro, Relax or Swim Fresh, all established for a long time in the water treatment industry.

Weight 6 kg
EAN

5060228496042

Manufacturer Part No

SFSUC/6

Brand

Certikin

GPSR Responsible Operator

Certikin International Ltd

GPSR Address Line 1

Unit 9 Witan Park

GPSR City

Witney

GPSR Post Code

OX28 4FJ

GPSR Country

UK

GPSR Email

[email protected]

GPSR Manufacturer Name

Certikin International Ltd

GPSR Warn Safety Info 01

Harmful if swallowed.

GPSR Warn Safety Info 02

Causes serious eye irritation.

GPSR Warn Safety Info 03

Very toxic to aquatic life with long lasting effects.

GPSR Warn Safety Info 04

May cause respiratory irritation.

9 reviews for Certikin Spafresh 1 Litre Surface Cleaner – Pack Of 6 (SFSUC/6)

  1. Leanne Sanderson

    Valid Review This is fantastic I was pleased with the product

  2. Simon Stone

    Registered Customer Great price for a good item

  3. Julie Hinchliffe

    Valid Customer Great price for this

  4. Neil Service

    Verified Customer Most Satisfied

  5. Joanne Stokes

    Confirmed Customer Great price for a great product.

  6. Alison Beecroft

    Registered PoolCleaners Customer Satisfied.

  7. Michelle Wilkinson (verified owner)

    Verified PoolCleaners Customer Satisfied with product

  8. Sarah Bettaney

    Confirmed Review Most Satisfied

  9. Neil Sutton (Charles Taylor)

    Registered Review Great price for this

Add a review

Deep Blue Pro PH Minus 7Kg PH- pH decreaser

  • pH Minus Granules: Easily lower your pool’s pH to the ideal level of 7.2 – 7.6 for maximum comfort and chemical efficiency.
  • Bather Comfort: Maintain a balanced pH for a soothing and enjoyable swimming experience every time.
  • Chemical Efficiency: Optimize the effectiveness of your pool chemicals by ensuring the
Read More »

1 litre Deep Blue Pro Pool Water Clarifier Concentrate

  • Shine and Clarity: Transform your pool water with Pool Sparkle Clarifier for a sparkling, crystal-clear finish.
  • Particle Aggregation: Say goodbye to cloudy water as the clarifier binds small waste particles for easy filtration.
  • Enhanced Filtration: Pool Sparkle helps your filter trap larger waste particles, improving water quality.
  • Easy Application:
Read More »

Plastica 20lt Relax Liquid Shock 14/15 percent

  • Industrial Strength Cleaning Power: Our Sodium Hypochlorite Solution is a high concentrate formula designed to swiftly remove moss, algae, and weeds from various surfaces.
  • Next Day Delivery: We prioritize your convenience with a next-day delivery service to ensure you can tackle your cleaning tasks promptly.
  • Multi-Purpose Applications: Ideal for
Read More »

Deep Blue Pro Premium Spa Chlorine Starter Kit

  • All-in-One Solution: The 9 part Spa starter kit includes essentials like stabilised Chlorine granules, Energize sachet, and pH Minus for complete spa water maintenance.
  • Enhanced Water Quality: Keep your spa water clean and safe with 500g Stabilised Chlorine granules that effectively sanitise and disinfect.
  • Energy Boost: The 30g Energize
Read More »

Deep Blue Pro Premium Spa Bromine Starter Kit

  • Stabilised Brominating Granules: Ensure your spa water stays clean and safe with this powerful sanitizer.
  • Energize Sachet: Revitalize your spa experience with a boost of energy for a refreshing soak.
  • pH Minus (500g & 750g): Easily adjust the pH levels to maintain optimal water balance for comfort.
  • No Foam
Read More »

Deep Blue Pro 500ml Spa Natural Clarifier

  • Fast Acting Clarifier: Deep Blue pro Clarifier swiftly removes body fats, oils, and dissolved metals, restoring water clarity.
  • Non-Toxic & Biodegradable: Safe for the environment and swimmers, ensuring a clean pool without harmful chemicals.
  • Enhanced Sanitiser Activity: By reducing fats and oils, it boosts the effectiveness of pool sanitizers.
Read More »
You were not leaving your cart just like that, right?

You were not leaving your trolley like that, were you?

Please enter your details below to save your trolley for later. If you have any questions please leave your email address and we will provide a swift response.

Certikin Spafresh 1 Litre Surface Cleaner - Pack Of 6 (SFSUC/6)
Certikin Spafresh 1 Litre Surface Cleaner – Pack Of 6 (SFSUC/6)

In stock

Title Quantity SALE price
Sale / Bulk discount 1 £138.60
Sale / Bulk discount 2 £133.40
Sale / Bulk discount 3 - 4 £129.94
Sale / Bulk discount 5 - 7 £128.21
Sale / Bulk discount 8 - 11 £124.74
Sale / Bulk discount 12 + £121.28