Certikin Spafresh 0.5 Litre System Flush – Pack Of 6 (SFSF/6)

15 people are viewing this product
Sales in the last 24 hours: 19

£162.45 £120.21

  • Efficient System Flush: The Certikin Spafresh 0.5 Litre System Flush effectively removes impurities and build-up, ensuring optimal spa performance.
  • Chemical Maintenance: This pack of 6 offers comprehensive chemical solutions for spa sanitation and maintenance, simplifying your spa care routine.
  • Spa Fresh Brochure: Access detailed information on product usage and benefits through the Spa Fresh brochure for informed decision-making.
  • Alkalinity Increaser: Includes an alkalinity increaser for balancing water pH levels, promoting a safe and enjoyable spa experience.
  • Hardness Increaser: Enhances water hardness for improved water quality, ensuring a comfortable and luxurious spa environment.
  • Surface Cleaner: The surface cleaner helps maintain cleanliness, prolonging the lifespan of your spa and keeping it looking pristine.
  • pH Reducer: Features a pH reducer to prevent pH spikes, maintaining water balance and protecting spa equipment from damage.
  • pH Plus: Includes pH plus solution for adjusting pH levels, creating an optimal environment for relaxation and enjoyment.
  • Chlorine Tablets: Multifunctional mini chlorine tablets offer continuous sanitation, keeping water clear and free from harmful bacteria.
  • Bromine Tablets: Bromine tablets provide an alternative sanitization method, ensuring spa water remains clean and safe for use.
  • Please check the stock note in the description for our quickest delivery times.

In stock|Current order processing time: 7 days

Title Quantity SALE price
Sale / Bulk discount 1 £129.96
Sale / Bulk discount 2 £125.09
Sale / Bulk discount 3 - 4 £121.84
Sale / Bulk discount 5 - 7 £120.21
Sale / Bulk discount 8 - 11 £116.96
Sale / Bulk discount 12 + £113.72

Certikin Spafresh 0.5 Litre System Flush is an integral part of the Spafresh range, designed to provide you with all the essential chemicals needed to maintain and sanitize your spa or hot tub. This pack includes 6 bottles of the system flush, offering you a convenient and cost-effective solution for keeping your spa water clean and clear.

One of the key benefits of using Certikin Spafresh System Flush is its ability to effectively remove any built-up residue, oils, and contaminants that may be present in your spa’s plumbing system. By using this product regularly as part of your maintenance routine, you can ensure that your spa operates efficiently and that the water remains crystal clear.

Each bottle contains 0.5 litres of the system flush solution, providing you with an ample amount to treat your spa multiple times. The concentrated formula means that you only need to use a small amount with each application, making it a long-lasting and reliable product for your spa maintenance needs.

Regularly flushing your spa system with Certikin Spafresh helps to prevent the buildup of scale and biofilm, which can lead to clogged pipes and reduced water circulation. This not only prolongs the life of your spa equipment but also ensures that your spa water stays fresh and hygienic for a more enjoyable and relaxing experience.

One of the unique selling points of Certikin Spafresh System Flush is its compatibility with a wide range of spa systems and hot tubs. Whether you have an acrylic, fiberglass, or vinyl spa, you can trust this product to effectively clean and maintain your system without causing any damage or corrosion.

Using Certikin Spafresh System Flush is easy and straightforward. Simply follow the instructions provided on the packaging to add the appropriate amount to your spa water and let the formula work its magic. Within a short period, you will notice a significant improvement in water clarity and overall spa performance.

Aside from its cleaning and sanitizing properties, Certikin Spafresh System Flush also helps to optimize the efficiency of your spa’s filtration system. By removing impurities and deposits that can hinder the filtration process, this product ensures that your spa water is constantly circulated and filtered effectively.

Furthermore, Certikin Spafresh System Flush is formulated to be environmentally friendly and safe for both your spa and its users. The gentle yet powerful formula is designed to provide thorough cleaning without harsh chemicals that could harm your spa equipment or the environment.

For added convenience, Certikin provides detailed product documentation for the Spafresh range, allowing you to access additional information and guidance on using the various chemicals effectively. You can refer to the Spa Fresh brochure and specific product guides to ensure that you make the most of your spa maintenance routine.

In conclusion, Certikin Spafresh 0.5 Litre System Flush is a must-have product for spa owners who prioritize cleanliness, efficiency, and longevity in their spa experience. With its effective cleaning power, compatibility with various spa systems, and environmentally friendly formula, this system flush is a reliable solution for maintaining your spa or hot tub in top condition.

Manufacturers description:

Certikin Spafresh 0.5 Litre System Flush – Pack Of 6

The Spafresh range contains all the chemicals necessary for maintaining and sanitising a spa or hot tub. Take a look at the Spa Fresh brochure for more details.

Product documentation:

chem_br_spafresh_guide-573.pdf

350msdsspafreshalkalinityincreaser201013-905.pdf

351msdsspafreshhardnessincreaser151113-906.pdf

352msdsspafreshsurfacecleaner201013-907.pdf

355msdsspafreshphreducer201013-908.pdf

356msdsspafreshphplus201013-909.pdf

357msdsspafreshmultifunctionminichlorinetablets151113-910.pdf

360msdsspafreshbrominetablets-un3085121113-911.pdf

363msdsspafreshsystemflush040213-912.pdf

365msdsspafreshfoamfree070114-913.pdf

Stock note: In an effort to provide the quickest possible delivery for our customers we may ship an alternative premium branded product if stocks are low. These brands will only be Blue Horizons, Deep Blue Pro, Relax or Swim Fresh, all established for a long time in the water treatment industry.

Weight 5 kg
EAN

5060228496004

Manufacturer Part No

SFSF/6

Brand

Certikin

GPSR Responsible Operator

Certikin International Ltd

GPSR Address Line 1

Unit 9 Witan Park

GPSR City

Witney

GPSR Post Code

OX28 4FJ

GPSR Country

UK

GPSR Email

info@certikin.co.uk

GPSR Manufacturer Name

Certikin International Ltd

GPSR Warn Safety Info 01

Harmful if swallowed.

GPSR Warn Safety Info 02

Causes serious eye irritation.

GPSR Warn Safety Info 03

Very toxic to aquatic life with long lasting effects.

GPSR Warn Safety Info 04

May cause respiratory irritation.

Plastica Nazca 6m x 4m Wooden Pool Package with Argonaut/Endurance Filtration & SwimMaster Counter Current With Patterned liner

  • Family-Sized Pool: The 6m x 4m Nazca Wooden swimming pool is perfect for family fun and relaxation, providing ample space for everyone to enjoy.
  • Aesthetically Pleasing: This pool enhances your garden’s beauty, seamlessly blending with the landscape for a stunning outdoor oasis.
  • Easy Self-Installation: With a complete self-build kit,
Read More »
You were not leaving your cart just like that, right?

You were not leaving your trolley like that, were you?

Please enter your details below to save your trolley for later. If you have any questions please leave your email address and we will provide a swift response.

Certikin Spafresh 0.5 Litre System Flush - Pack Of 6 (SFSF/6)
Certikin Spafresh 0.5 Litre System Flush – Pack Of 6 (SFSF/6)

In stock|Current order processing time: 7 days

Title Quantity SALE price
Sale / Bulk discount 1 £129.96
Sale / Bulk discount 2 £125.09
Sale / Bulk discount 3 - 4 £121.84
Sale / Bulk discount 5 - 7 £120.21
Sale / Bulk discount 8 - 11 £116.96
Sale / Bulk discount 12 + £113.72